Lineage for d1whua_ (1whu A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723626Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family) (S)
  5. 1723627Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)
  6. 1723628Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species)
    links two duplicated two-domain units formed by domains 1-2 and 4-5
  7. 1723629Species Mouse (Mus musculus) [TaxId:10090] [116815] (1 PDB entry)
    Uniprot Q8K1R3 273-363
  8. 1723630Domain d1whua_: 1whu A: [114651]
    Structural genomics target

Details for d1whua_

PDB Entry: 1whu (more details)

PDB Description: Solution structure of the alpha-helical domain from mouse hypothetical PNPase
PDB Compounds: (A:) polynucleotide phosphorylase; 3'-5' RNA exonuclease

SCOPe Domain Sequences for d1whua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whua_ a.4.9.1 (A:) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpqkiftpsaeivkytkiiameklyavftdyehdkvsrdeavnkirldteehlk
ekfpevdqfeiiesfnivakevfrsiilneykrcdgrdsgpssg

SCOPe Domain Coordinates for d1whua_:

Click to download the PDB-style file with coordinates for d1whua_.
(The format of our PDB-style files is described here.)

Timeline for d1whua_: