SCOP 1.71: Domain d1wh9a_: 1wh9 A:

Lineage for d1wh9a_ (1wh9 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117914] (1 PDB entry)

8. Domain d1wh9a_: 1wh9 A: [114637]
   Structural genomics target

Details for d1wh9a_

PDB Entry: 1wh9

PDB Description: solution structure of the kh domain of human ribosomal protein s3

SCOP Domain Sequences for d1wh9a_:

Sequence; same for both SEQRES and ATOM records:

>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus)}
gssgssgfkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrirel
tavvqkrfgfpegsvelyaekvatrgsgpssg

Timeline for d1wh9a_:

• d1wh9a_ is new in SCOP 1.71
  
• d1wh9a_ appears in SCOP 1.73
  
• d1wh9a_ appears in the current release, SCOPe 2.08, called d1wh9a1