![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117914] (1 PDB entry) Uniprot P23396 17-95 |
![]() | Domain d1wh9a1: 1wh9 A:8-86 [114637] Other proteins in same PDB: d1wh9a2, d1wh9a3 Structural genomics target |
PDB Entry: 1wh9 (more details)
SCOPe Domain Sequences for d1wh9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wh9a1 d.52.3.1 (A:8-86) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} fkaelnefltrelaedgysgvevrvtptrteiiilatrtqnvlgekgrrireltavvqkr fgfpegsvelyaekvatrg
Timeline for d1wh9a1: