SCOPe 2.08: Domain d1wgda1: 1wgd A:8-88

Lineage for d1wgda1 (1wgd A:8-88)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 [117802] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117803] (1 PDB entry)
   Uniprot Q15011 10-90

8. Domain d1wgda1: 1wgd A:8-88 [114610]
   Other proteins in same PDB: d1wgda2, d1wgda3
   Structural genomics target

Details for d1wgda1

PDB Entry: 1wgd

PDB Description: solution structure of the ubl-domain of herp

PDB Compounds: (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein

SCOPe Domain Sequences for d1wgda1:

Sequence; same for both SEQRES and ATOM records:

>d1wgda1 d.15.1.1 (A:8-88) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]}
vtllvkspnqrhrdlelsgdrgwsvghlkahlsrvyperprpedqrliysgkllldhqcl
rdllpkqekrhvlhlvcnvks

Timeline for d1wgda1:

• d1wgda1 first appeared in SCOP 1.71, called d1wgda_
  
• d1wgda1 appears in SCOPe 2.07