SCOPe 2.04: Domain d1wfta_: 1wft A:

Lineage for d1wfta_ (1wft A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Host cell factor 2, HCF-2 [117051] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117052] (1 PDB entry)
   Uniprot Q9D968 127-236

8. Domain d1wfta_: 1wft A: [114592]
   Structural genomics target; 2nd FnIII domain (of 2)

Details for d1wfta_

PDB Entry: 1wft

PDB Description: solution structure of c-terminal fibronectin type iii domain of mouse 1700129l13rik protein

PDB Compounds: (A:) 1700129L13Rik protein

SCOPe Domain Sequences for d1wfta_:

Sequence; same for both SEQRES and ATOM records:

>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpgapstvrisknvdgihlswepptspsgnileysaylairtaqmqdnpsqlvf
mriycglktsctvtagqlanahidytsrpaivfrisaknekgygpatqirwlqgnsksgp
ssg

Timeline for d1wfta_:

• d1wfta_ first appeared in SCOP 1.71
  
• d1wfta_ appears in SCOPe 2.03
  
• d1wfta_ appears in SCOPe 2.05
  
• d1wfta_ appears in the current release, SCOPe 2.08, called d1wfta1