| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein GTPase Era, N-terminal domain [52637] (2 species) |
| Species Thermus thermophilus [TaxId:274] [117533] (1 PDB entry) |
| Domain d1wf3a1: 1wf3 A:3-180 [114574] Other proteins in same PDB: d1wf3a2 Structural genomics target complexed with gnp, gol, mg |
PDB Entry: 1wf3 (more details), 1.88 Å
SCOP Domain Sequences for d1wf3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus}
ektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdt
pglhkpmdalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpill
vgnkldaakypeeamkayhellpeaeprmlsalderqvaelkadllalmpegpffype
Timeline for d1wf3a1: