Lineage for d1wf3a1 (1wf3 A:3-180)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582078Protein GTPase Era, N-terminal domain [52637] (2 species)
  7. 582082Species Thermus thermophilus [TaxId:274] [117533] (1 PDB entry)
  8. 582083Domain d1wf3a1: 1wf3 A:3-180 [114574]
    Other proteins in same PDB: d1wf3a2
    Structural genomics target
    complexed with gnp, gol, mg

Details for d1wf3a1

PDB Entry: 1wf3 (more details), 1.88 Å

PDB Description: Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
PDB Compounds: (A:)

SCOP Domain Sequences for d1wf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus}
ektysgfvaivgkpnvgkstllnnllgvkvapisprpqttrkrlrgiltegrrqivfvdt
pglhkpmdalgefmdqevyealadvnavvwvvdlrhpptpedelvaralkplvgkvpill
vgnkldaakypeeamkayhellpeaeprmlsalderqvaelkadllalmpegpffype

SCOP Domain Coordinates for d1wf3a1:

Click to download the PDB-style file with coordinates for d1wf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wf3a2