Lineage for d1wf2a_ (1wf2 A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) 
Family d.58.7.1: Canonical RBD [54929] (32 proteins) 
Protein Heterogeneous nuclear ribonucleoproteins C1/C2 [117961] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117962] (1 PDB entry) 
Domain d1wf2a_: 1wf2 A: [114573]
Structural genomics target
Details for d1wf2a_
PDB Entry: 1wf2 (more details)
PDB Description: solution structure of rrm domain in hnrpc protein
SCOP Domain Sequences for d1wf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens)}
gssgssgktdprsmnsrvfignlntlvvkksdveaifskygkivgcsvhkgfafvqyvne
rnaraavagedgrmiagqvldinlaaepkvnrsgpssg
SCOP Domain Coordinates for d1wf2a_:
Click to download the PDB-style file with coordinates for d1wf2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wf2a_:
- d1wf2a_ is new in SCOP 1.71
- d1wf2a_ appears in SCOP 1.73
- d1wf2a_ appears in the current release, SCOPe 2.08, called d1wf2a1
View in 3D