Lineage for d1weya_ (1wey A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908452Protein Calcipressin-1 [117953] (1 species)
  7. 1908453Species Mouse (Mus musculus) [TaxId:10090] [117954] (1 PDB entry)
    Uniprot Q9JHG6 14-103
  8. 1908454Domain d1weya_: 1wey A: [114569]
    Structural genomics target; splicing variant

Details for d1weya_

PDB Entry: 1wey (more details)

PDB Description: Solution structure of RRM domain in calcipressin 1
PDB Compounds: (A:) calcipressin 1

SCOPe Domain Sequences for d1weya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgliacvanddvfsesetrakfeslfrtydkdttfqyfksfkrvrinfsnplsaa
darlrlhkteflgkemklyfaqtlhigsshlappnpdksgpssg

SCOPe Domain Coordinates for d1weya_:

Click to download the PDB-style file with coordinates for d1weya_.
(The format of our PDB-style files is described here.)

Timeline for d1weya_: