Lineage for d1we6a_ (1we6 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853681Protein Splicing factor 3 subunit 1, C-terminal domain [117799] (3 species)
  7. 853686Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117801] (1 PDB entry)
    SQ Q8RXF1 683-780; T5E21.13/At1g14650
  8. 853687Domain d1we6a_: 1we6 A: [114546]
    Structural genomics target

Details for d1we6a_

PDB Entry: 1we6 (more details)

PDB Description: solution structure of ubiquitin-like domain in splicing factor aal91182
PDB Compounds: (A:) splicing factor, putative

SCOP Domain Sequences for d1we6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgkfdesalvpedqflaqhpgpatirvskpnendgqfmeitvqslsenvgslkek
iageiqipankqklsgkagflkdnmslahynvgageiltlslrersgpssg

SCOP Domain Coordinates for d1we6a_:

Click to download the PDB-style file with coordinates for d1we6a_.
(The format of our PDB-style files is described here.)

Timeline for d1we6a_: