Lineage for d1we1b_ (1we1 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544344Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 544345Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 544346Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 544366Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 544415Species Synechocystis sp. [TaxId:1143] [117032] (1 PDB entry)
  8. 544417Domain d1we1b_: 1we1 B: [114543]

Details for d1we1b_

PDB Entry: 1we1 (more details), 2.5 Å

PDB Description: Crystal structure of heme oxygenase-1 from cyanobacterium Synechocystis sp. PCC6803 in complex with heme

SCOP Domain Sequences for d1we1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we1b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Synechocystis sp.}
svnlasqlregtkkshsmaenvgfvkcflkgvveknsyrklvgnlyfvysameeemakfk
dhpilshiyfpelnrkqsleqdlqfyygsnwrqevkisaagqayvdrvrqvaatapellv
ahsytrylgdlsggqilkkiaqnamnlhdggtafyefadiddekafkntyrqamndlpid
qataerivdeandafamnmkmfnelegnlikaigimvfnslt

SCOP Domain Coordinates for d1we1b_:

Click to download the PDB-style file with coordinates for d1we1b_.
(The format of our PDB-style files is described here.)

Timeline for d1we1b_: