SCOP 1.75: Domain d1wdda2: 1wdd A:11-150

Lineage for d1wdda2 (1wdd A:11-150)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [117976] (1 PDB entry)
   Uniprot P12089

8. Domain d1wdda2: 1wdd A:11-150 [114529]
   Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_

Details for d1wdda2

PDB Entry: 1wdd, 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate

PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1wdda2:

Sequence; same for both SEQRES and ATOM records:

>d1wdda2 d.58.9.1 (A:11-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
vgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvw
tdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkal
ralrledlripptysktfqg

Timeline for d1wdda2:

• d1wdda2 first appeared in SCOP 1.71
  
• d1wdda2 appears in SCOP 1.73
  
• d1wdda2 appears in SCOPe 2.01
  
• d1wdda2 appears in the current release, SCOPe 2.08