Lineage for d1wc5a1 (1wc5 A:1005-1198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954780Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 2954781Protein Adenylate cyclase CyaC [117982] (1 species)
  7. 2954782Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
    Uniprot O32393 1004-1200
  8. 2954788Domain d1wc5a1: 1wc5 A:1005-1198 [114499]
    Other proteins in same PDB: d1wc5a2, d1wc5b2, d1wc5c2
    complexed with apc, ca, mg

Details for d1wc5a1

PDB Entry: 1wc5 (more details), 2.3 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp in presence of bicarbonate
PDB Compounds: (A:) adenylate cyclase

SCOPe Domain Sequences for d1wc5a1:

Sequence, based on SEQRES records: (download)

>d1wc5a1 d.58.29.1 (A:1005-1198) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpn

Sequence, based on observed residues (ATOM records): (download)

>d1wc5a1 d.58.29.1 (A:1005-1198) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrvppvrfrcgihqgmav
vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
depvmtcvinpn

SCOPe Domain Coordinates for d1wc5a1:

Click to download the PDB-style file with coordinates for d1wc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wc5a1: