SCOPe 2.06: Domain d1wc0a1: 1wc0 A:1005-1200

Lineage for d1wc0a1 (1wc0 A:1005-1200)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylate cyclase CyaC [117982] (1 species)

7. Species Spirulina platensis [TaxId:118562] [117983] (6 PDB entries)
   Uniprot O32393 1004-1200

8. Domain d1wc0a1: 1wc0 A:1005-1200 [114490]
   Other proteins in same PDB: d1wc0a2, d1wc0b2
   complexed with apc, ca

Details for d1wc0a1

PDB Entry: 1wc0, 2.4 Å

PDB Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-atp

PDB Compounds: (A:) adenylate cyclase

SCOPe Domain Sequences for d1wc0a1:

Sequence; same for both SEQRES and ATOM records:

>d1wc0a1 d.58.29.1 (A:1005-1200) Adenylate cyclase CyaC {Spirulina platensis [TaxId: 118562]}
rpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdaim
alygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgihqgm
avvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelk
gidepvmtcvinpnml

Timeline for d1wc0a1:

• d1wc0a1 first appeared in SCOP 1.71, called d1wc0a_
  
• d1wc0a1 was called d1wc0a_ in SCOPe 2.05
  
• d1wc0a1 appears in SCOPe 2.07
  
• d1wc0a1 appears in the current release, SCOPe 2.08