Lineage for d1wb3c4 (1wb3 C:1-179)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582023Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 582024Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
  8. 582035Domain d1wb3c4: 1wb3 C:1-179 [114474]
    Other proteins in same PDB: d1wb3a1, d1wb3a2, d1wb3a3, d1wb3b1, d1wb3b2, d1wb3c1, d1wb3c2, d1wb3c3, d1wb3d1, d1wb3d2

Details for d1wb3c4

PDB Entry: 1wb3 (more details), 3.2 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with the GTP analogue GppNHp

SCOP Domain Sequences for d1wb3c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb3c4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

SCOP Domain Coordinates for d1wb3c4:

Click to download the PDB-style file with coordinates for d1wb3c4.
(The format of our PDB-style files is described here.)

Timeline for d1wb3c4: