Lineage for d1wb3a3 (1wb3 A:272-387)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561274Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561275Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 561276Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins)
  6. 561288Protein Elongation factor SelB, domain 3 [117223] (1 species)
  7. 561289Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)
  8. 561298Domain d1wb3a3: 1wb3 A:272-387 [114466]
    Other proteins in same PDB: d1wb3a1, d1wb3a2, d1wb3a4, d1wb3b1, d1wb3b3, d1wb3c1, d1wb3c2, d1wb3c4, d1wb3d1, d1wb3d3

Details for d1wb3a3

PDB Entry: 1wb3 (more details), 3.2 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with the GTP analogue GppNHp

SCOP Domain Sequences for d1wb3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb3a3 b.44.1.1 (A:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

SCOP Domain Coordinates for d1wb3a3:

Click to download the PDB-style file with coordinates for d1wb3a3.
(The format of our PDB-style files is described here.)

Timeline for d1wb3a3: