Lineage for d1w9ub2 (1w9u B:299-360)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720614Protein Chitinase 1 [54562] (2 species)
  7. 720615Species Aspergillus fumigatus [TaxId:5085] [117868] (9 PDB entries)
  8. 720619Domain d1w9ub2: 1w9u B:299-360 [114423]
    Other proteins in same PDB: d1w9ua1, d1w9ub1
    complexed with rig, so4

Details for d1w9ub2

PDB Entry: 1w9u (more details), 1.85 Å

PDB Description: specificity and affnity of natural product cyclopentapeptide inhibitor argadin against aspergillus fumigatus chitinase
PDB Compounds: (B:) chitinase

SCOP Domain Sequences for d1w9ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9ub2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

SCOP Domain Coordinates for d1w9ub2:

Click to download the PDB-style file with coordinates for d1w9ub2.
(The format of our PDB-style files is described here.)

Timeline for d1w9ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w9ub1