Lineage for d1w88j_ (1w88 J:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986630Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1986631Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1986632Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)
  6. 1986641Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 1986642Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
    Uniprot P11961 118-170
    Uniprot Q8VV74 128-169
  8. 1986646Domain d1w88j_: 1w88 J: [114362]
    Other proteins in same PDB: d1w88a_, d1w88b1, d1w88b2, d1w88c_, d1w88d1, d1w88d2, d1w88e_, d1w88f1, d1w88f2, d1w88g_, d1w88h1, d1w88h2
    complexed with mg, tdp

Details for d1w88j_

PDB Entry: 1w88 (more details), 2.3 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2
PDB Compounds: (J:) dihydrolipoyllysine-residue acetyltransferase component of pyruvate

SCOPe Domain Sequences for d1w88j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w88j_ a.9.1.1 (J:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg

SCOPe Domain Coordinates for d1w88j_:

Click to download the PDB-style file with coordinates for d1w88j_.
(The format of our PDB-style files is described here.)

Timeline for d1w88j_: