Lineage for d1w85i_ (1w85 I:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637071Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 637072Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) (S)
  5. 637073Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)
  6. 637083Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 637084Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
  8. 637085Domain d1w85i_: 1w85 I: [114347]
    Other proteins in same PDB: d1w85a_, d1w85b1, d1w85b2, d1w85c_, d1w85d1, d1w85d2, d1w85e_, d1w85f1, d1w85f2, d1w85g_, d1w85h1, d1w85h2

Details for d1w85i_

PDB Entry: 1w85 (more details), 2 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2
PDB Compounds: (I:) dihydrolipoyllysine-residue acetyltransferase component of pyruvate

SCOP Domain Sequences for d1w85i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflag

SCOP Domain Coordinates for d1w85i_:

Click to download the PDB-style file with coordinates for d1w85i_.
(The format of our PDB-style files is described here.)

Timeline for d1w85i_: