Lineage for d1w7pb1 (1w7p B:1-125)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907073Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. 907074Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)
  7. 907075Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries)
    Uniprot P47142
  8. 907088Domain d1w7pb1: 1w7p B:1-125 [114321]
    Other proteins in same PDB: d1w7pa1, d1w7pa2, d1w7pd1, d1w7pd2

Details for d1w7pb1

PDB Entry: 1w7p (more details), 3.6 Å

PDB Description: the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36)
PDB Compounds: (B:) vps25, yjr102c

SCOPe Domain Sequences for d1w7pb1:

Sequence, based on SEQRES records: (download)

>d1w7pb1 a.4.5.54 (B:1-125) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
yfilw

Sequence, based on observed residues (ATOM records): (download)

>d1w7pb1 a.4.5.54 (B:1-125) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvinsknlfn
nediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilw

SCOPe Domain Coordinates for d1w7pb1:

Click to download the PDB-style file with coordinates for d1w7pb1.
(The format of our PDB-style files is described here.)

Timeline for d1w7pb1: