SCOPe 2.05: Domain d1w72m2: 1w72 M:108-211

Lineage for d1w72m2 (1w72 M:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1w72m2: 1w72 M:108-211 [114306]
   Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72m1
   complexed with gol

Details for d1w72m2

PDB Entry: 1w72, 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

PDB Compounds: (M:) hyb3 light chain

SCOPe Domain Sequences for d1w72m2:

Sequence; same for both SEQRES and ATOM records:

>d1w72m2 b.1.1.2 (M:108-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d1w72m2:

• d1w72m2 first appeared in SCOP 1.71
  
• d1w72m2 appears in SCOPe 2.04
  
• d1w72m2 appears in SCOPe 2.06
  
• d1w72m2 appears in the current release, SCOPe 2.08