Lineage for d1w72m1 (1w72 M:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512286Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1512364Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1512368Domain d1w72m1: 1w72 M:1-107 [114305]
    Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l2, d1w72m2
    complexed with gol

Details for d1w72m1

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (M:) hyb3 light chain

SCOPe Domain Sequences for d1w72m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72m1 b.1.1.1 (M:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
syvltqppsvsvapgqtaritcggnnigsrsvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgnmatltisrveagdeadyycqvwdsrtdhwvfgggtdltvlg

SCOPe Domain Coordinates for d1w72m1:

Click to download the PDB-style file with coordinates for d1w72m1.
(The format of our PDB-style files is described here.)

Timeline for d1w72m1: