Lineage for d1w72l2 (1w72 L:108-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028905Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2028990Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2028994Domain d1w72l2: 1w72 L:108-211 [114304]
    Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b1, d1w72b2, d1w72d1, d1w72d2, d1w72e1, d1w72e2, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72m1
    complexed with gol

Details for d1w72l2

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (L:) hyb3 light chain

SCOPe Domain Sequences for d1w72l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72l2 b.1.1.2 (L:108-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d1w72l2:

Click to download the PDB-style file with coordinates for d1w72l2.
(The format of our PDB-style files is described here.)

Timeline for d1w72l2: