Lineage for d1w72l1 (1w72 L:1-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931241Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 931322Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 931325Domain d1w72l1: 1w72 L:1-107 [114303]
    Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l2, d1w72m2
    complexed with gol

Details for d1w72l1

PDB Entry: 1w72 (more details), 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3
PDB Compounds: (L:) hyb3 light chain

SCOPe Domain Sequences for d1w72l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
syvltqppsvsvapgqtaritcggnnigsrsvhwyqqkpgqapvlvvyddsdrpsgiper
fsgsnsgnmatltisrveagdeadyycqvwdsrtdhwvfgggtdltvlg

SCOPe Domain Coordinates for d1w72l1:

Click to download the PDB-style file with coordinates for d1w72l1.
(The format of our PDB-style files is described here.)

Timeline for d1w72l1: