Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d1w72h2: 1w72 H:114-228 [114300] Other proteins in same PDB: d1w72a1, d1w72a2, d1w72b_, d1w72d1, d1w72d2, d1w72e_, d1w72h1, d1w72i1, d1w72l1, d1w72l2, d1w72m1, d1w72m2 complexed with gol |
PDB Entry: 1w72 (more details), 2.15 Å
SCOPe Domain Sequences for d1w72h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w72h2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1w72h2: