SCOP 1.71: Domain d1w72a1: 1w72 A:182-274

Lineage for d1w72a1 (1w72 A:182-274)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (76 PDB entries)

8. Domain d1w72a1: 1w72 A:182-274 [114293]
   Other proteins in same PDB: d1w72a2, d1w72b_, d1w72d2, d1w72e_, d1w72h1, d1w72h2, d1w72i1, d1w72i2, d1w72l1, d1w72l2, d1w72m1, d1w72m2

Details for d1w72a1

PDB Entry: 1w72, 2.15 Å

PDB Description: crystal structure of hla-a1:mage-a1 in complex with fab-hyb3

SCOP Domain Sequences for d1w72a1:

Sequence; same for both SEQRES and ATOM records:

>d1w72a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrw

Timeline for d1w72a1:

• d1w72a1 is new in SCOP 1.71
  
• d1w72a1 appears in SCOP 1.73
  
• d1w72a1 appears in the current release, SCOPe 2.08