SCOPe 2.06: Domain d1w6sd_: 1w6s D:

Lineage for d1w6sd_ (1w6s D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries)
   Uniprot P14775

8. Domain d1w6sd_: 1w6s D: [114287]
   Other proteins in same PDB: d1w6sa_, d1w6sc_
   complexed with ca, gol, pqq

Details for d1w6sd_

PDB Entry: 1w6s, 1.2 Å

PDB Description: the high resolution structure of methanol dehydrogenase from methylobacterium extorquens

PDB Compounds: (D:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d1w6sd_:

Sequence; same for both SEQRES and ATOM records:

>d1w6sd_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa

Timeline for d1w6sd_:

• d1w6sd_ first appeared in SCOP 1.71
  
• d1w6sd_ appears in SCOPe 2.05
  
• d1w6sd_ appears in SCOPe 2.07
  
• d1w6sd_ appears in the current release, SCOPe 2.08