Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein beta-keto acyl carrier protein reductase [51788] (5 species) |
Species Streptomyces coelicolor [TaxId:1902] [117408] (3 PDB entries) |
Domain d1w4zb_: 1w4z B: [114196] complexed with fmt, nap |
PDB Entry: 1w4z (more details), 2.5 Å
SCOP Domain Sequences for d1w4zb_:
Sequence, based on SEQRES records: (download)
>d1w4zb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor} lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl elartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpseva emvayligpgaaavtaqalnvcgglgny
>d1w4zb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor} lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl elartgitvnavcpgfvetpmaasvrehyteeafdritarvpigryvqpsevaemvayli gpgaaavtaqalnvcgglgny
Timeline for d1w4zb_: