Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Pea (Pisum sativum) [TaxId:3888] [54420] (2 PDB entries) Uniprot Q43077 |
Domain d1w2zc3: 1w2z C:99-206 [114114] Other proteins in same PDB: d1w2za1, d1w2zb1, d1w2zc1, d1w2zd1 complexed with cu, iod, mn, nag, xe |
PDB Entry: 1w2z (more details), 2.24 Å
SCOPe Domain Sequences for d1w2zc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2zc3 d.17.2.1 (C:99-206) Copper amine oxidase, domains 1 and 2 {Pea (Pisum sativum) [TaxId: 3888]} gfpilsvdeqslaiklplkyppfidsvkkrglnlseivcssftmgwfgeeknvrtvrldc fmkestvniyvrpitgitivadldlmkiveyhdrdieavptaenteyq
Timeline for d1w2zc3: