Lineage for d1w2zc2 (1w2z C:6-98)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718735Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 718736Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 718737Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 718890Species Pea seedling (Pisum sativum) [TaxId:3888] [54420] (2 PDB entries)
  8. 718895Domain d1w2zc2: 1w2z C:6-98 [114113]
    Other proteins in same PDB: d1w2za1, d1w2zb1, d1w2zc1, d1w2zd1

Details for d1w2zc2

PDB Entry: 1w2z (more details), 2.24 Å

PDB Description: psao and xenon
PDB Compounds: (C:) amine oxidase, copper containing

SCOP Domain Sequences for d1w2zc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2zc2 d.17.2.1 (C:6-98) Copper amine oxidase, domains 1 and 2 {Pea seedling (Pisum sativum) [TaxId: 3888]}
vqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptlvsipr
kifvvaiinsqtheilinlrirsivsdnihngy

SCOP Domain Coordinates for d1w2zc2:

Click to download the PDB-style file with coordinates for d1w2zc2.
(The format of our PDB-style files is described here.)

Timeline for d1w2zc2: