Lineage for d1w2zc2 (1w2z C:6-98)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [54420] (2 PDB entries)
    Uniprot Q43077
  8. Domain d1w2zc2: 1w2z C:6-98 [114113]
    Other proteins in same PDB: d1w2za1, d1w2zb1, d1w2zc1, d1w2zd1
    complexed with cu, iod, mn, nag, xe

Details for d1w2zc2

PDB Entry: 1w2z (more details), 2.24 Å

PDB Description: psao and xenon
PDB Compounds: (C:) amine oxidase, copper containing

SCOPe Domain Sequences for d1w2zc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2zc2 d.17.2.1 (C:6-98) Copper amine oxidase, domains 1 and 2 {Pea (Pisum sativum) [TaxId: 3888]}
vqhpldpltkeeflavqtivqnkypisnnrlafhyiglddpekdhvlryethptlvsipr
kifvvaiinsqtheilinlrirsivsdnihngy

SCOPe Domain Coordinates for d1w2zc2 are not available.

Timeline for d1w2zc2:

Domains from same chain:
(mouse over for more information)
d1w2zc1, d1w2zc3
Domains from other chains:
(mouse over for more information)
d1w2za1, d1w2za2, d1w2za3, d1w2zb1, d1w2zb2, d1w2zb3, d1w2zd1, d1w2zd2, d1w2zd3