Lineage for d1w2zc1 (1w2z C:207-647)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [50002] (2 PDB entries)
    Uniprot Q43077
  8. Domain d1w2zc1: 1w2z C:207-647 [114112]
    Other proteins in same PDB: d1w2za2, d1w2za3, d1w2zb2, d1w2zb3, d1w2zc2, d1w2zc3, d1w2zd2, d1w2zd3
    complexed with cu, iod, mn, nag, xe

Details for d1w2zc1

PDB Entry: 1w2z (more details), 2.24 Å

PDB Description: psao and xenon
PDB Compounds: (C:) amine oxidase, copper containing

SCOPe Domain Sequences for d1w2zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2zc1 b.30.2.1 (C:207-647) Copper amine oxidase, domain 3 {Pea (Pisum sativum) [TaxId: 3888]}
vskqsppfgpkqhsltshqpqgpgfqinghsvswanwkfhigfdvragivislasiydle
khksrrvlykgyiselfvpyqdpteefyfktffdsgefgfglstvslipnrdcpphaqfi
dtyvhsangtpillknaicvfeqygnimwrhtengipnesieesrtevnlivrtivtvgn
ydnvidwefkasgsikpsialsgileikgtnikhkdeikedlhgklvsansigiyhdhfy
iyyldfdidgthnsfektslktvrikdgsskrksywttetqtaktesdakitiglapael
vvvnpniktavgnevgyrlipaipahpllteddypqirgaftnynvwvtaynrtekwagg
lyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvpaqedfpimpllstsfelrptn
ffernpvlktlsprdvawpgc

SCOPe Domain Coordinates for d1w2zc1 are not available.

Timeline for d1w2zc1:

Domains from same chain:
(mouse over for more information)
d1w2zc2, d1w2zc3
Domains from other chains:
(mouse over for more information)
d1w2za1, d1w2za2, d1w2za3, d1w2zb1, d1w2zb2, d1w2zb3, d1w2zd1, d1w2zd2, d1w2zd3