Lineage for d1w2zb3 (1w2z B:99-206)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181140Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 2181141Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2181142Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2181337Species Pea (Pisum sativum) [TaxId:3888] [54420] (2 PDB entries)
    Uniprot Q43077
  8. 2181341Domain d1w2zb3: 1w2z B:99-206 [114111]
    Other proteins in same PDB: d1w2za1, d1w2zb1, d1w2zc1, d1w2zd1
    complexed with cu, iod, mn, nag, xe

Details for d1w2zb3

PDB Entry: 1w2z (more details), 2.24 Å

PDB Description: psao and xenon
PDB Compounds: (B:) amine oxidase, copper containing

SCOPe Domain Sequences for d1w2zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2zb3 d.17.2.1 (B:99-206) Copper amine oxidase, domains 1 and 2 {Pea (Pisum sativum) [TaxId: 3888]}
gfpilsvdeqslaiklplkyppfidsvkkrglnlseivcssftmgwfgeeknvrtvrldc
fmkestvniyvrpitgitivadldlmkiveyhdrdieavptaenteyq

SCOPe Domain Coordinates for d1w2zb3:

Click to download the PDB-style file with coordinates for d1w2zb3.
(The format of our PDB-style files is described here.)

Timeline for d1w2zb3: