SCOPe 2.03: Domain d1vpoh1: 1vpo H:1-118

Lineage for d1vpoh1 (1vpo H:1-118)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
   Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity

8. Domain d1vpoh1: 1vpo H:1-118 [113970]
   Other proteins in same PDB: d1vpoh2, d1vpol1, d1vpol2
   MQ P18527 P01863 # natural chimera; anti-testosterone antibody (Fab)
   complexed with tes

Details for d1vpoh1

PDB Entry: 1vpo, 2.15 Å

PDB Description: crystal structure analysis of the anti-testosterone fab in complex with testosterone

PDB Compounds: (H:) anti-testosterone (heavy chain)

SCOPe Domain Sequences for d1vpoh1:

Sequence; same for both SEQRES and ATOM records:

>d1vpoh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvss

Timeline for d1vpoh1:

• d1vpoh1 first appeared in SCOP 1.71
  
• d1vpoh1 appears in SCOPe 2.02
  
• d1vpoh1 appears in SCOPe 2.04
  
• d1vpoh1 appears in the current release, SCOPe 2.08