Lineage for d1vpja_ (1vpj A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
this domain is thought to be mobile in most multi-domain proteins known to contain it
Superfamily c.8.9: FumA C-terminal domain-like [117457] (1 family) 
Family c.8.9.1: FumA C-terminal domain-like [117458] (1 protein)
Pfam 05683Protein Fumarate hydratase class I beta subunit [117459] (1 species) Species Archaeoglobus fulgidus [TaxId:2234] [117460] (1 PDB entry) 
Domain d1vpja_: 1vpj A: [113961]
Details for d1vpja_
PDB Entry: 1vpj (more details), 1.69 Å
PDB Description: Crystal structure of Fumarase (FUM-1) (NP_069927.1) from Archaeoglobus fulgidus at 1.69 A resolution
SCOP Domain Sequences for d1vpja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpja_ c.8.9.1 (A:) Fumarate hydratase class I beta subunit {Archaeoglobus fulgidus}
vmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsfdkgvv
yhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevveamrgka
ayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpcivaidahgnslyr
SCOP Domain Coordinates for d1vpja_:
Click to download the PDB-style file with coordinates for d1vpja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vpja_:
- d1vpja_ is new in SCOP 1.71
- d1vpja_ does not appear in SCOP 1.73
View in 3D
