Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1vp02_: 1vp0 2: [113904] 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex |
PDB Entry: 1vp0 (more details), 11.5 Å
SCOPe Domain Sequences for d1vp02_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp02_ i.1.1.1 (2:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
Timeline for d1vp02_:
View in 3D Domains from other chains: (mouse over for more information) d1vp01_, d1vp03_, d1vp04_, d1vp05_, d1vp06_, d1vp07_, d1vp0d_, d1vp0e_, d1vp0f_, d1vp0g_, d1vp0h_, d1vp0i_, d1vp0j_, d1vp0k_, d1vp0l_, d1vp0m_, d1vp0n_, d1vp0o_, d1vp0p_, d1vp0q_, d1vp0r_, d1vp0s_, d1vp0t_, d1vp0u_, d1vp0v_, d1vp0w_, d1vp0x_, d1vp0y_, d1vp0z_ |