Lineage for d1vozs_ (1voz S:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896760Domain d1vozs_: 1voz S: [113901]
    30S subunit; the coordinates of 50S subunit in a different PDB entry

Details for d1vozs_

PDB Entry: 1voz (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d1vozs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vozs_ i.1.1.1 (S:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1vozs_:

Click to download the PDB-style file with coordinates for d1vozs_.
(The format of our PDB-style files is described here.)

Timeline for d1vozs_: