SCOPe 2.05: Domain d1vozc_: 1voz C:

Lineage for d1vozc_ (1voz C:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1vozc_: 1voz C: [113885]
   30S subunit; the coordinates of 50S subunit in a different PDB entry
   protein/RNA complex
   protein/RNA complex

Details for d1vozc_

PDB Entry: 1voz, 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1vozc_:

Sequence; same for both SEQRES and ATOM records:

>d1vozc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

Timeline for d1vozc_:

• d1vozc_ first appeared in SCOP 1.71
  
• d1vozc_ appears in SCOPe 2.04
  
• d1vozc_ appears in SCOPe 2.06
  
• d1vozc_ appears in the current release, SCOPe 2.08