Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1voys_: 1voy S: [113875] 50S subunit; the coordinates of 30S subunit in a different PDB entry |
PDB Entry: 1voy (more details), 11.5 Å
SCOP Domain Sequences for d1voys_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1voys_ i.1.1.1 (S:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
Timeline for d1voys_:
View in 3D Domains from other chains: (mouse over for more information) d1voy1_, d1voy2_, d1voy3_, d1voy4_, d1voy5_, d1voy6_, d1voy7_, d1voyd_, d1voye_, d1voyf_, d1voyg_, d1voyh_, d1voyi_, d1voyj_, d1voyk_, d1voyl_, d1voym_, d1voyn_, d1voyo_, d1voyp_, d1voyq_, d1voyr_, d1voyt_, d1voyu_, d1voyv_, d1voyw_, d1voyx_, d1voyy_, d1voyz_ |