Lineage for d1voyo_ (1voy O:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3043038Domain d1voyo_: 1voy O: [113871]
    Other proteins in same PDB: d1voy72
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex
    protein/RNA complex

Details for d1voyo_

PDB Entry: 1voy (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (O:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1voyo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voyo_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv

SCOPe Domain Coordinates for d1voyo_:

Click to download the PDB-style file with coordinates for d1voyo_.
(The format of our PDB-style files is described here.)

Timeline for d1voyo_: