Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1vowi_: 1vow I: [113815] 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex |
PDB Entry: 1vow (more details), 11.5 Å
SCOPe Domain Sequences for d1vowi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vowi_ i.1.1.1 (I:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
Timeline for d1vowi_:
View in 3D Domains from other chains: (mouse over for more information) d1vow1_, d1vow2_, d1vow3_, d1vow4_, d1vow5_, d1vow6_, d1vow7_, d1vowd_, d1vowe_, d1vowf_, d1vowg_, d1vowh_, d1vowj_, d1vowk_, d1vowl_, d1vowm_, d1vown_, d1vowo_, d1vowp_, d1vowq_, d1vowr_, d1vows_, d1vowt_, d1vowu_, d1vowv_, d1voww_, d1vowx_, d1vowy_, d1vowz_ |