SCOP 1.75: Domain d1vow4_: 1vow 4:

Lineage for d1vow4_ (1vow 4:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1vow4_: 1vow 4: [113806]
   50S subunit; the coordinates of 30S subunit in a different PDB entry

Details for d1vow4_

PDB Entry: 1vow, 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

PDB Compounds: (4:) 50S ribosomal protein L34

SCOP Domain Sequences for d1vow4_:

Sequence; same for both SEQRES and ATOM records:

>d1vow4_ i.1.1.1 (4:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

Timeline for d1vow4_:

• d1vow4_ first appeared in SCOP 1.71
  
• d1vow4_ appears in SCOP 1.73
  
• d1vow4_ appears in SCOPe 2.01
  
• d1vow4_ appears in the current release, SCOPe 2.08