SCOPe 2.05: Domain d1vova_: 1vov a:

Lineage for d1vova_ (1vov a:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1vova_: 1vov a: [113783]
   30S subunit; the coordinates of 50S subunit in a different PDB entry
   protein/RNA complex
   protein/RNA complex

Details for d1vova_

PDB Entry: 1vov, 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

PDB Compounds: (a:) protein Y

SCOPe Domain Sequences for d1vova_:

Sequence; same for both SEQRES and ATOM records:

>d1vova_ i.1.1.1 (a:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
tmnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvl
vasgkhedmytainelinklerqlnklqhk

Timeline for d1vova_:

• d1vova_ first appeared in SCOP 1.71
  
• d1vova_ appears in SCOPe 2.04
  
• d1vova_ appears in SCOPe 2.06
  
• d1vova_ appears in the current release, SCOPe 2.08