Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1vou5_: 1vou 5: [113757] 50S subunit; the coordinates of 30S subunit in a different PDB entry protein/RNA complex |
PDB Entry: 1vou (more details), 11.5 Å
SCOPe Domain Sequences for d1vou5_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vou5_ i.1.1.1 (5:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm lpr
Timeline for d1vou5_:
View in 3D Domains from other chains: (mouse over for more information) d1vou1_, d1vou2_, d1vou3_, d1vou4_, d1vou6_, d1vou7_, d1voud_, d1voue_, d1vouf_, d1voug_, d1vouh_, d1voui_, d1vouj_, d1vouk_, d1voul_, d1voum_, d1voun_, d1vouo_, d1voup_, d1vouq_, d1vour_, d1vous_, d1vout_, d1vouu_, d1vouv_, d1vouw_, d1voux_, d1vouy_, d1vouz_ |