Lineage for d1vosl_ (1vos L:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1467866Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1468212Domain d1vosl_: 1vos L: [113744]
    30S subunit; the coordinates of 50S subunit in a different PDB entry
    protein/RNA complex

Details for d1vosl_

PDB Entry: 1vos (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1vosl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vosl_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d1vosl_:

Click to download the PDB-style file with coordinates for d1vosl_.
(The format of our PDB-style files is described here.)

Timeline for d1vosl_: