Lineage for d1vor3_ (1vor 3:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1248493Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1248896Domain d1vor3_: 1vor 3: [113705]
    50S subunit; the coordinates of 30S subunit in a different PDB entry
    protein/RNA complex

Details for d1vor3_

PDB Entry: 1vor (more details), 11.5 Å

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
PDB Compounds: (3:) 50S ribosomal protein L33

SCOPe Domain Sequences for d1vor3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vor3_ i.1.1.1 (3:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOPe Domain Coordinates for d1vor3_:

Click to download the PDB-style file with coordinates for d1vor3_.
(The format of our PDB-style files is described here.)

Timeline for d1vor3_: