Lineage for d1voqc_ (1voq C:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627218Domain d1voqc_: 1voq C: [113685]

Details for d1voqc_

PDB Entry: 1voq (more details)

PDB Description: Crystal structure of five 70s ribosomes from Escherichia Coli in complex with protein Y. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.

SCOP Domain Sequences for d1voqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1voqc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1voqc_:

Click to download the PDB-style file with coordinates for d1voqc_.
(The format of our PDB-style files is described here.)

Timeline for d1voqc_: