Lineage for d1vmba_ (1vmb A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725083Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 725084Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 725085Protein Ribosomal protein S6 [54997] (2 species)
  7. 725086Species Thermotoga maritima [TaxId:2336] [117978] (1 PDB entry)
  8. 725087Domain d1vmba_: 1vmb A: [113672]
    Structural genomics target
    complexed with edo

Details for d1vmba_

PDB Entry: 1vmb (more details), 1.7 Å

PDB Description: Crystal structure of 30S ribosomal protein S6 (TM0603) from Thermotoga maritima at 1.70 A resolution
PDB Compounds: (A:) 30S ribosomal protein S6

SCOP Domain Sequences for d1vmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmba_ d.58.14.1 (A:) Ribosomal protein S6 {Thermotoga maritima [TaxId: 2336]}
keriyesmfiiapnvpeeerenlvervkkiieervkgkidkvermgmrkfayeikkfneg
dytviyfrcdgqnlqelenfyrvtpeiirwqtfrrfdlekkerkaqr

SCOP Domain Coordinates for d1vmba_:

Click to download the PDB-style file with coordinates for d1vmba_.
(The format of our PDB-style files is described here.)

Timeline for d1vmba_: