Lineage for d1vgsi_ (1vgs I:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 585201Family c.47.1.10: Glutathione peroxidase-like [52901] (18 proteins)
  6. 585250Protein Peroxiredoxin [117601] (1 species)
  7. 585251Species Aeropyrum pernix [TaxId:56636] [117602] (1 PDB entry)
  8. 585260Domain d1vgsi_: 1vgs I: [113661]

Details for d1vgsi_

PDB Entry: 1vgs (more details), 2.31 Å

PDB Description: Crystal Structure of Peroxiredoxin from an Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1

SCOP Domain Sequences for d1vgsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgsi_ c.47.1.10 (I:) Peroxiredoxin {Aeropyrum pernix}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
y

SCOP Domain Coordinates for d1vgsi_:

Click to download the PDB-style file with coordinates for d1vgsi_.
(The format of our PDB-style files is described here.)

Timeline for d1vgsi_:

  • d1vgsi_ is new in SCOP 1.71
  • d1vgsi_ does not appear in SCOP 1.73