Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (18 proteins) |
Protein Peroxiredoxin [117601] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [117602] (1 PDB entry) |
Domain d1vgsd_: 1vgs D: [113656] |
PDB Entry: 1vgs (more details), 2.31 Å
SCOP Domain Sequences for d1vgsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgsd_ c.47.1.10 (D:) Peroxiredoxin {Aeropyrum pernix} pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll ye
Timeline for d1vgsd_: