Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (2 families) similar putative active site with a conserved cysteine residue |
Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins) Pfam PF01106 |
Protein HIRA-interacting protein 5, HIRIP5 [117918] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117919] (1 PDB entry) Uniprot Q9QZ23 106-185 |
Domain d1veha_: 1veh A: [113635] Structural genomics target |
PDB Entry: 1veh (more details)
SCOP Domain Sequences for d1veha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgseeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscps siitlksgiqnmlqfyipevegveqvsgpssg
Timeline for d1veha_: