Lineage for d1veha_ (1veh A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860346Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (2 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 860347Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins)
    Pfam PF01106
  6. 860348Protein HIRA-interacting protein 5, HIRIP5 [117918] (1 species)
  7. 860349Species Mouse (Mus musculus) [TaxId:10090] [117919] (1 PDB entry)
    Uniprot Q9QZ23 106-185
  8. 860350Domain d1veha_: 1veh A: [113635]
    Structural genomics target

Details for d1veha_

PDB Entry: 1veh (more details)

PDB Description: solution structure of rsgi ruh-018, a nifu-like domain of hirip5 protein from mouse cdna
PDB Compounds: (A:) NifU-like protein HIRIP5

SCOP Domain Sequences for d1veha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgseeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscps
siitlksgiqnmlqfyipevegveqvsgpssg

SCOP Domain Coordinates for d1veha_:

Click to download the PDB-style file with coordinates for d1veha_.
(The format of our PDB-style files is described here.)

Timeline for d1veha_: